PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.005G047400.1
Common NamePHAVU_005G047400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 323aa    MW: 36698.2 Da    PI: 7.5013
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.005G047400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.12e-181360148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg W++eEde+lv++++ +G ++W++++++ g+ R++k+c++rw +yl
  Phvul.005G047400.1 13 RGLWSPEEDEKLVRYINIHGHKSWSSVPKYAGLQRCGKSCRLRWINYL 60
                        788*******************************************97 PP

2Myb_DNA-binding55.61.2e-1766109146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg++T+eE+++++d ++ lG++ W+ Ia++++ gRt++++k++w++
  Phvul.005G047400.1  66 RGSFTAEEEQIIIDIHRILGNR-WAQIAKHLP-GRTDNEVKNFWNS 109
                         89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.9E-26563IPR009057Homeodomain-like
PROSITE profilePS5129419.073860IPR017930Myb domain
SuperFamilySSF466892.46E-3010107IPR009057Homeodomain-like
SMARTSM007173.0E-141262IPR001005SANT/Myb domain
PfamPF002496.8E-171360IPR001005SANT/Myb domain
CDDcd001674.33E-121660No hitNo description
PROSITE profilePS5129426.46861115IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2664116IPR009057Homeodomain-like
SMARTSM007171.8E-1665113IPR001005SANT/Myb domain
PfamPF002498.3E-1666109IPR001005SANT/Myb domain
CDDcd001675.62E-1268108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MGHRCCSKQR IKRGLWSPEE DEKLVRYINI HGHKSWSSVP KYAGLQRCGK SCRLRWINYL  60
RPDLKRGSFT AEEEQIIIDI HRILGNRWAQ IAKHLPGRTD NEVKNFWNSC IKKKLISQGL  120
DPQTHNLLSS HRRSSASTIS NMHQNSNSIF IMSSHTPNAP VKTTFQTFSS LPKPPPNIVQ  180
TPSSFVTSEY QTSPIISNKF SSDWPCELLM DNASNICSPS YMNPTAVELS NNESVANWVS  240
RVNVDDFRSQ TLEERTQVLV QQEKDKICED MGTDVREANK GYLESSASFE SSNFDFGLLE  300
SVLSSEFISH DLSCMDELAW NF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-32131157108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00350DAPTransfer from AT3G12720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007149171.10.0hypothetical protein PHAVU_005G047400g
TrEMBLV7BVV50.0V7BVV5_PHAVU; Uncharacterized protein
STRINGGLYMA08G17371.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34663267
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.12e-81myb domain protein 67